PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.339230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 211aa    MW: 23710.9 Da    PI: 10.2942
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.339230.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
   Cucsa.339230.1 14 RGLWTAEEDAKILAYVSNHGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.81.6e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E++l++++++  G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.339230.1  69 SFTPQEEDLIIKLHQAIGSR-WSVIAKQLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.293965IPR017930Myb domain
SuperFamilySSF466892.52E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002495.2E-161461IPR001005SANT/Myb domain
CDDcd001676.62E-121761No hitNo description
Gene3DG3DSA:1.10.10.609.7E-2565116IPR009057Homeodomain-like
SMARTSM007175.4E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129417.61266116IPR017930Myb domain
CDDcd001672.40E-1169112No hitNo description
PfamPF002491.7E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGKPPCCDKS NVKRGLWTAE EDAKILAYVS NHGVGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLRHDSF TPQEEDLIIK LHQAIGSRWS VIAKQLPGRT DNDVKNYWNT KLRKKLLKMG  120
IDPITHKPFS QILFDYGSIS SLQTTPKPLM GPFNKTLTPT TTMAKSQQPF SSGTNMGEQF  180
QFQTPKKPYI LKEQPTSSSC SSSSINGSET X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-171LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-171LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147487.11e-156PREDICTED: myb-related protein Zm38
SwissprotQ9LSI72e-79MYB35_ARATH; Transcription factor MYB35
TrEMBLA5BSP61e-95A5BSP6_VITVI; Putative uncharacterized protein
STRINGVIT_14s0066g02180.t014e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-80MYB family protein